PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Migut.H01775.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Phrymaceae; Erythranthe
Family WRKY
Protein Properties Length: 136aa    MW: 15791.2 Da    PI: 9.0715
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Migut.H01775.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY61.91.1e-19965360
                      -SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
              WRKY  3 DgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60
                      D+y W  YG+++v g++fp  YYrC+++gC+v+kk  rs   ++++ei+Y+++H+h+k
  Migut.H01775.1.p  9 DEYLWIQYGKRVVGGNDFPVRYYRCSYPGCTVRKKCVRSP-TGEITEIVYRDSHHHPK 65
                      99**************************************.9**************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5081116.386266IPR003657WRKY domain
SuperFamilySSF1182906.28E-16466IPR003657WRKY domain
Gene3DG3DSA:2.20.25.801.7E-16566IPR003657WRKY domain
SMARTSM007741.3E-10765IPR003657WRKY domain
PfamPF031063.1E-14964IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 136 aa     Download sequence    Send to blast
MTGHTLPYDE YLWIQYGKRV VGGNDFPVRY YRCSYPGCTV RKKCVRSPTG EITEIVYRDS  60
HHHPKPHLID IDLSFATRDG NRWKEHPTTS DSLLRLTMAS TTMVSLLSRI SEYNIFGSIK  120
MLIFQFFKIM FYEAV*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38470.17e-18WRKY DNA-binding protein 33